Fig. 4
From: Middle-down electron capture dissociation and electron transfer dissociation for histone analysis
By fragmenting the peptide bonds, collision-induced dissociation (CID) produces b- and y-ions of unequal intensity, while electron capture/transfer dissociation (EC/TD) fragments between the alpha carbon and the amine adjacent to the peptide bonds, thus producing c- and z-ions of approximately the same intensity, aiding both the identification of PTMs and the quantification of the peptides. A comparison for the synthetic H3 histone N-terminal fragment ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE is shown with CID (a) and ETD (b)